Lineage for d4o8aa1 (4o8a A:88-261)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285097Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 1285098Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 1285112Family a.176.1.0: automated matches [227131] (1 protein)
    not a true family
  6. 1285113Protein automated matches [226832] (1 species)
    not a true protein
  7. 1285114Species Escherichia coli [TaxId:83333] [224852] (6 PDB entries)
  8. 1285120Domain d4o8aa1: 4o8a A:88-261 [236088]
    Other proteins in same PDB: d4o8aa2
    automated match to d1k87a1
    complexed with 2op, fad, pg4

Details for d4o8aa1

PDB Entry: 4o8a (more details), 2 Å

PDB Description: First structure of a proline utilization A proline dehydrogenase domain
PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d4o8aa1:

Sequence, based on SEQRES records: (download)

>d4o8aa1 a.176.1.0 (A:88-261) automated matches {Escherichia coli [TaxId: 83333]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn
aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d4o8aa1 a.176.1.0 (A:88-261) automated matches {Escherichia coli [TaxId: 83333]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllslssqegvalmclaeallripdkatrdallirkgvdmamrlmgeqfvt

SCOPe Domain Coordinates for d4o8aa1:

Click to download the PDB-style file with coordinates for d4o8aa1.
(The format of our PDB-style files is described here.)

Timeline for d4o8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4o8aa2