Lineage for d4o8aa1 (4o8a A:88-261)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014214Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 2014215Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 2014216Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)
  6. 2014217Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
    includes the N-terminal swapping arm made of three helices; possible DNA-binding function
  7. 2014221Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
    Uniprot P09546 87-610
  8. 2014225Domain d4o8aa1: 4o8a A:88-261 [236088]
    Other proteins in same PDB: d4o8aa2
    complexed with 2op, fad, pg4

Details for d4o8aa1

PDB Entry: 4o8a (more details), 2 Å

PDB Description: First structure of a proline utilization A proline dehydrogenase domain
PDB Compounds: (A:) Bifunctional protein putA

SCOPe Domain Sequences for d4o8aa1:

Sequence, based on SEQRES records: (download)

>d4o8aa1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn
aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d4o8aa1 a.176.1.1 (A:88-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllslssqegvalmclaeallripdkatrdallirkgvdmamrlmgeqfvt

SCOPe Domain Coordinates for d4o8aa1:

Click to download the PDB-style file with coordinates for d4o8aa1.
(The format of our PDB-style files is described here.)

Timeline for d4o8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4o8aa2