![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Pyrobaculum aerophilum [TaxId:178306] [236086] (1 PDB entry) |
![]() | Domain d4o29a1: 4o29 A:1-205 [236087] Other proteins in same PDB: d4o29a2 automated match to d2pbfa_ complexed with sah |
PDB Entry: 4o29 (more details), 2.9 Å
SCOPe Domain Sequences for d4o29a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o29a1 c.66.1.0 (A:1-205) automated matches {Pyrobaculum aerophilum [TaxId: 178306]} makrlveelerdgivkservkralltvpreefvlpeyrmmayedrplplfagatisaphm vammcelieprpgmkilevgtgsgyhaavcaeaiekkgriytieivkelavfaaqnlerl gywgvvevyhgdgkkglekhapfdaiivtaaadvippalirqlkdggvmvipveerlgqv lykvvkrgdkiekkaityvmfvplr
Timeline for d4o29a1: