SCOPe 2.07: Domain d4o29a1: 4o29 A:1-205

Lineage for d4o29a1 (4o29 A:1-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (66 species)
   not a true protein

7. Species Pyrobaculum aerophilum [TaxId:178306] [236086] (1 PDB entry)

8. Domain d4o29a1: 4o29 A:1-205 [236087]
   Other proteins in same PDB: d4o29a2
   automated match to d2pbfa_
   complexed with sah

Details for d4o29a1

PDB Entry: 4o29, 2.9 Å

PDB Description: protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine

PDB Compounds: (A:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d4o29a1:

Sequence; same for both SEQRES and ATOM records:

>d4o29a1 c.66.1.0 (A:1-205) automated matches {Pyrobaculum aerophilum [TaxId: 178306]}
makrlveelerdgivkservkralltvpreefvlpeyrmmayedrplplfagatisaphm
vammcelieprpgmkilevgtgsgyhaavcaeaiekkgriytieivkelavfaaqnlerl
gywgvvevyhgdgkkglekhapfdaiivtaaadvippalirqlkdggvmvipveerlgqv
lykvvkrgdkiekkaityvmfvplr

Timeline for d4o29a1:

• d4o29a1 first appeared in SCOPe 2.03, called d4o29a_
  
• d4o29a1 appears in SCOPe 2.06