SCOPe 2.06: Domain d4nzpa2: 4nzp A:177-406

Lineage for d4nzpa2 (4nzp A:177-406)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
   unusual fold

4. Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families)

5. Family d.210.1.0: automated matches [227194] (1 protein)
   not a true family

6. Protein automated matches [226921] (3 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [236080] (1 PDB entry)

8. Domain d4nzpa2: 4nzp A:177-406 [236081]
   Other proteins in same PDB: d4nzpa1
   automated match to d1vl2a2

Details for d4nzpa2

PDB Entry: 4nzp, 2.31 Å

PDB Description: The crystal structure of argininosuccinate synthase from Campylobacter jejuni subsp. jejuni NCTC 11168

PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d4nzpa2:

Sequence, based on SEQRES records:

>d4nzpa2 d.210.1.0 (A:177-406) automated matches {Campylobacter jejuni [TaxId: 192222]}
kspysmdanllhisyeglvledpahapeedmwrwskspkdapneseiieldfqkgdlvai
ngeklspaglltklnelgckhgigrldivenryvgmksrgcyetpggtillkahralesi
tldreaahlkdelmpkyasliyngywfspermmlqalidesqihangrvklelykgnvmv
igresandslfnaayctfeedevynqkdaagfiklnalrfiiagkngrkf

Sequence, based on observed residues (ATOM records):

>d4nzpa2 d.210.1.0 (A:177-406) automated matches {Campylobacter jejuni [TaxId: 192222]}
kspysmdanllhisyeglvledpahapeedmwrwskspkdapneseiieldfqkgdlvai
ngeklspaglltklnelgckhgigrldivenryvgmksrgcyetpggtillkahralesi
tldreaahlkdelmpkyasliyngywfspermmlqalidesqihangrvklelykgnvmv
igresandslfnvynqkdaagfiklnalrfiiagkngrkf

Timeline for d4nzpa2:

• d4nzpa2 first appeared in SCOPe 2.03
  
• d4nzpa2 appears in SCOPe 2.05
  
• d4nzpa2 appears in SCOPe 2.07
  
• d4nzpa2 appears in the current release, SCOPe 2.08