SCOP 1.73: Domain d1blbb1: 1blb B:-2-85

Lineage for d1blbb1 (1blb B:-2-85)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
sandwich; 8 strands in 2 sheets; greek-key
duplication: has internal pseudo twofold symmetry
Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
Protein beta-Crystallin [49702] (4 species)
duplication consists of two domains of this fold
Species Cow (Bos taurus) [TaxId:9913] [49703] (3 PDB entries)
Domain d1blbb1: 1blb B:-2-85 [23608]

Details for d1blbb1

PDB Entry: 1blb (more details), 3.3 Å

PDB Description: close packing of an oligomeric eye lens beta-crystallin induces loss of symmetry and ordering of sequence extensions

PDB Compounds: (B:) beta b2-crystallin

SCOP Domain Sequences for d1blbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blbb1 b.11.1.1 (B:-2-85) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]}
lnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckgeqfvf
ekgeyprwdswtssrrtdslsslrpikvds

SCOP Domain Coordinates for d1blbb1:

Click to download the PDB-style file with coordinates for d1blbb1.
(The format of our PDB-style files is described here.)

Timeline for d1blbb1: