![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) ![]() |
![]() | Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) |
![]() | Protein beta-Crystallin [49702] (4 species) duplication consists of two domains of this fold |
![]() | Species Cow (Bos taurus) [TaxId:9913] [49703] (3 PDB entries) |
![]() | Domain d1blbb1: 1blb B:-2-85 [23608] |
PDB Entry: 1blb (more details), 3.3 Å
SCOP Domain Sequences for d1blbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blbb1 b.11.1.1 (B:-2-85) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]} lnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckgeqfvf ekgeyprwdswtssrrtdslsslrpikvds
Timeline for d1blbb1: