SCOP 1.55: Domain d1blbb1: 1blb B:-2-85

Lineage for d1blbb1 (1blb B:-2-85)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (5 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein beta-Crystallin [49702] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49703] (2 PDB entries)

8. Domain d1blbb1: 1blb B:-2-85 [23608]

Details for d1blbb1

PDB Entry: 1blb, 3.3 Å

PDB Description: close packing of an oligomeric eye lens beta-crystallin induces loss of symmetry and ordering of sequence extensions

SCOP Domain Sequences for d1blbb1:

Sequence; same for both SEQRES and ATOM records:

>d1blbb1 b.11.1.1 (B:-2-85) beta-Crystallin {Cow (Bos taurus)}
lnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckgeqfvf
ekgeyprwdswtssrrtdslsslrpikvds

Timeline for d1blbb1:

• d1blbb1 appears in SCOP 1.57
  
• d1blbb1 appears in the current release, SCOPe 2.08