Lineage for d4n6xa1 (4n6x A:11-99)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395842Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)
  8. 2395843Domain d4n6xa1: 4n6x A:11-99 [236071]
    Other proteins in same PDB: d4n6xa2
    automated match to d4jl7a_
    complexed with cl

Details for d4n6xa1

PDB Entry: 4n6x (more details), 1.05 Å

PDB Description: Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain of NHERF1
PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF1/Chemokine Receptor CXCR2 fusion protein

SCOPe Domain Sequences for d4n6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n6xa1 b.36.1.1 (A:11-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenveke
thqqvvsriraalnavrllvvdpetsttl

SCOPe Domain Coordinates for d4n6xa1:

Click to download the PDB-style file with coordinates for d4n6xa1.
(The format of our PDB-style files is described here.)

Timeline for d4n6xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n6xa2