Class b: All beta proteins [48724] (174 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) |
Protein beta-Crystallin [49702] (4 species) duplication consists of two domains of this fold |
Species Cow (Bos taurus) [TaxId:9913] [49703] (3 PDB entries) |
Domain d1blba2: 1blb A:86-175 [23607] |
PDB Entry: 1blb (more details), 3.3 Å
SCOP Domain Sequences for d1blba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blba2 b.11.1.1 (A:86-175) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]} qehkitlyenpnftgkkmevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqy llekgdykdsgdfgapqpqvqsvrrirdmqw
Timeline for d1blba2: