Lineage for d4mx5x_ (4mx5 X:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939585Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1939586Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1939587Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1939687Protein Ricin A-chain [56389] (1 species)
  7. 1939688Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (37 PDB entries)
    Uniprot P06750 28-286
  8. 1939697Domain d4mx5x_: 4mx5 X: [236067]
    automated match to d1br6a_
    complexed with 5mx

Details for d4mx5x_

PDB Entry: 4mx5 (more details), 1.52 Å

PDB Description: structure of ricin a chain bound with benzyl-(2-(2-amino-4-oxo-3,4- dihydropteridine-7-carboxamido)ethyl)carbamate
PDB Compounds: (X:) ricin a chain

SCOPe Domain Sequences for d4mx5x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mx5x_ d.165.1.1 (X:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcapppssqf

SCOPe Domain Coordinates for d4mx5x_:

Click to download the PDB-style file with coordinates for d4mx5x_.
(The format of our PDB-style files is described here.)

Timeline for d4mx5x_: