Lineage for d4mvha_ (4mvh A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342579Species Human (Homo sapiens) [TaxId:9606] [188676] (122 PDB entries)
  8. 2342742Domain d4mvha_: 4mvh A: [236064]
    automated match to d4muwa_
    complexed with 2f5, so4, zn

Details for d4mvha_

PDB Entry: 4mvh (more details), 2.5 Å

PDB Description: Crystal Structure of PDE10A with Novel Keto-Benzimidazole Inhibitor
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4mvha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mvha_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrv
pyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpl
aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
kqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
mkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqw
ekvirge

SCOPe Domain Coordinates for d4mvha_:

Click to download the PDB-style file with coordinates for d4mvha_.
(The format of our PDB-style files is described here.)

Timeline for d4mvha_: