SCOPe 2.06: Domain d4mpmb_: 4mpm B:

Lineage for d4mpmb_ (4mpm B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [100979] (2 PDB entries)

8. Domain d4mpmb_: 4mpm B: [236061]
   automated match to d1oj6b_
   complexed with hem

Details for d4mpmb_

PDB Entry: 4mpm, 1.74 Å

PDB Description: Wild-type human neuroglobin

PDB Compounds: (B:) neuroglobin

SCOPe Domain Sequences for d4mpmb_:

Sequence; same for both SEQRES and ATOM records:

>d4mpmb_ a.1.1.2 (B:) Neuroglobin {Human (Homo sapiens) [TaxId: 9606]}
erpepelirqswravsrsplehgtvlfarlfalepdllplfqyncrqfsspedclsspef
ldhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekcl
gpaftpatraawsqlygavvqamsrgwd

Timeline for d4mpmb_:

• d4mpmb_ first appeared in SCOPe 2.03
  
• d4mpmb_ appears in SCOPe 2.05
  
• d4mpmb_ appears in SCOPe 2.07
  
• d4mpmb_ appears in the current release, SCOPe 2.08