![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Neuroglobin [100978] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [100979] (2 PDB entries) |
![]() | Domain d4mpmb_: 4mpm B: [236061] automated match to d1oj6b_ complexed with hem |
PDB Entry: 4mpm (more details), 1.74 Å
SCOPe Domain Sequences for d4mpmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mpmb_ a.1.1.2 (B:) Neuroglobin {Human (Homo sapiens) [TaxId: 9606]} erpepelirqswravsrsplehgtvlfarlfalepdllplfqyncrqfsspedclsspef ldhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekcl gpaftpatraawsqlygavvqamsrgwd
Timeline for d4mpmb_: