Lineage for d4mjua_ (4mju A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2398638Protein automated matches [190692] (14 species)
    not a true protein
  7. 2398654Species Influenza A virus (a/duck/ukraine/1/1963(h3n8)) [TaxId:385580] [189572] (10 PDB entries)
  8. 2398660Domain d4mjua_: 4mju A: [236058]
    automated match to d4ks3a_
    complexed with 27s, ca

Details for d4mjua_

PDB Entry: 4mju (more details), 2.35 Å

PDB Description: influenza neuraminidase in complex with a novel antiviral compound
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4mjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mjua_ b.68.1.0 (A:) automated matches {Influenza A virus (a/duck/ukraine/1/1963(h3n8)) [TaxId: 385580]}
tymnnteaicdvkgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvinswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqadisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
sdtprgedaqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdidk

SCOPe Domain Coordinates for d4mjua_:

Click to download the PDB-style file with coordinates for d4mjua_.
(The format of our PDB-style files is described here.)

Timeline for d4mjua_: