SCOPe 2.03: Domain d4lmma_: 4lmm A:

Lineage for d4lmma_ (4lmm A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [228456] (5 PDB entries)

8. Domain d4lmma_: 4lmm A: [236051]
   automated match to d4jl7a_
   complexed with acy, cl

Details for d4lmma_

PDB Entry: 4lmm, 1.1 Å

PDB Description: Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21 space group

PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF1

SCOPe Domain Sequences for d4lmma_:

Sequence; same for both SEQRES and ATOM records:

>d4lmma_ b.36.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
gmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
kethqqvvsriraalnavrllvvdpetsttl

Timeline for d4lmma_:

• d4lmma_ is new in SCOPe 2.03-stable
  
• d4lmma_ appears in SCOPe 2.04
  
• d4lmma_ appears in the current release, SCOPe 2.08, called d4lmma1