| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4ki5d2: 4ki5 D:107-213 [236050] Other proteins in same PDB: d4ki5c_, d4ki5e2, d4ki5f2, d4ki5m_ automated match to d1n0xl2 |
PDB Entry: 4ki5 (more details), 2.47 Å
SCOPe Domain Sequences for d4ki5d2:
Sequence, based on SEQRES records: (download)
>d4ki5d2 b.1.1.0 (D:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
>d4ki5d2 b.1.1.0 (D:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathstspivksfnrnec
Timeline for d4ki5d2: