SCOPe 2.08: Domain d4ki5d2: 4ki5 D:107-213

Lineage for d4ki5d2 (4ki5 D:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4ki5d2: 4ki5 D:107-213 [236050]
   Other proteins in same PDB: d4ki5c_, d4ki5e2, d4ki5f2, d4ki5m_
   automated match to d1n0xl2

Details for d4ki5d2

PDB Entry: 4ki5, 2.47 Å

PDB Description: Cystal structure of human factor VIII C2 domain in a ternary complex with murine inhbitory antibodies 3E6 and G99

PDB Compounds: (D:) murine monoclonal 3e6 fab light chain

SCOPe Domain Sequences for d4ki5d2:

Sequence, based on SEQRES records:

>d4ki5d2 b.1.1.0 (D:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Sequence, based on observed residues (ATOM records):

>d4ki5d2 b.1.1.0 (D:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathstspivksfnrnec

Timeline for d4ki5d2:

• d4ki5d2 first appeared in SCOPe 2.03
  
• d4ki5d2 appears in SCOPe 2.07