SCOPe 2.07: Domain d2bb2a2: 2bb2 A:86-175

Lineage for d2bb2a2 (2bb2 A:86-175)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Cow (Bos taurus) [TaxId:9913] [49703] (2 PDB entries)

8. Domain d2bb2a2: 2bb2 A:86-175 [23605]
   complexed with bme

Details for d2bb2a2

PDB Entry: 2bb2, 2.1 Å

PDB Description: x-ray analysis of beta b2-crystallin and evolution of oligomeric lens proteins

PDB Compounds: (A:) beta b2-crystallin

SCOPe Domain Sequences for d2bb2a2:

Sequence; same for both SEQRES and ATOM records:

>d2bb2a2 b.11.1.1 (A:86-175) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]}
qehkitlyenpnftgkkmevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqy
llekgdykdsgdfgapqpqvqsvrrirdmqw

Timeline for d2bb2a2:

• d2bb2a2 first appeared (with stable ids) in SCOP 1.55, called d2bb2_2
  
• d2bb2a2 appears in SCOPe 2.06
  
• d2bb2a2 appears in the current release, SCOPe 2.08