Lineage for d2bb2a2 (2bb2 A:86-175)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773467Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2773468Species Cow (Bos taurus) [TaxId:9913] [49703] (2 PDB entries)
  8. 2773470Domain d2bb2a2: 2bb2 A:86-175 [23605]
    complexed with bme

Details for d2bb2a2

PDB Entry: 2bb2 (more details), 2.1 Å

PDB Description: x-ray analysis of beta b2-crystallin and evolution of oligomeric lens proteins
PDB Compounds: (A:) beta b2-crystallin

SCOPe Domain Sequences for d2bb2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bb2a2 b.11.1.1 (A:86-175) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]}
qehkitlyenpnftgkkmevidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqy
llekgdykdsgdfgapqpqvqsvrrirdmqw

SCOPe Domain Coordinates for d2bb2a2:

Click to download the PDB-style file with coordinates for d2bb2a2.
(The format of our PDB-style files is described here.)

Timeline for d2bb2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bb2a1