![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Acidaminococcus fermentans [TaxId:591001] [236043] (1 PDB entry) |
![]() | Domain d4l1fb2: 4l1f B:229-380 [236046] Other proteins in same PDB: d4l1fa1, d4l1fb1 automated match to d4o5md2 complexed with cos, fad, na, pdo, po4 |
PDB Entry: 4l1f (more details), 1.79 Å
SCOPe Domain Sequences for d4l1fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l1fb2 a.29.3.0 (B:229-380) automated matches {Acidaminococcus fermentans [TaxId: 591001]} gegfkiametldggrigvaaqalgiaegalaaavkyskereqfgrsiskfqalqfmmadm atkieaarylvyhaamlknegkpyseaaamakcfasdvamevttdavqifggygytvdyp aerymrnakitqiyegtnqvmrivtsrallrd
Timeline for d4l1fb2: