| Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
| Protein automated matches [226934] (14 species) not a true protein |
| Species Acidaminococcus fermentans [TaxId:591001] [236041] (1 PDB entry) |
| Domain d4l1fb1: 4l1f B:1-228 [236045] Other proteins in same PDB: d4l1fa2, d4l1fb2 automated match to d4o5md1 complexed with cos, fad, na, pdo, po4 |
PDB Entry: 4l1f (more details), 1.79 Å
SCOPe Domain Sequences for d4l1fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l1fb1 e.6.1.0 (B:1-228) automated matches {Acidaminococcus fermentans [TaxId: 591001]}
mdfnltedqqmikdmaaefaekflaptveerdkahiwdrklidkmgeagfcgicfpeeyg
gmgldvlsyilaveelskvddgtgitlsanvslcatpiymfgteeqkqkylapiaegthv
gafgltepsagtdasaqqttavlkgdkyilngskifitngkeadtyvvfamtdksqgvhg
isafilekgmpgfrfgkiedkmgghtsitaelifedcevpkenllgke
Timeline for d4l1fb1: