Lineage for d2bb2_1 (2bb2 -2-85)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) 
Protein beta-Crystallin [49702] (3 species) 
Species Cow (Bos taurus) [TaxId:9913] [49703] (2 PDB entries) 
Domain d2bb2_1: 2bb2 -2-85 [23604]
Details for d2bb2_1
PDB Entry: 2bb2 (more details), 2.1 Å
PDB Description: x-ray analysis of beta b2-crystallin and evolution of oligomeric lens proteins
SCOP Domain Sequences for d2bb2_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bb2_1 b.11.1.1 (-2-85) beta-Crystallin {Cow (Bos taurus)}
lnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckgeqfvf
ekgeyprwdswtssrrtdslsslrpikvds
SCOP Domain Coordinates for d2bb2_1:
Click to download the PDB-style file with coordinates for d2bb2_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bb2_1:
- d2bb2_1 first appeared (with stable ids) in SCOP 1.55
- d2bb2_1 appears in SCOP 1.59
- d2bb2_1 appears in the current release, SCOPe 2.08, called d2bb2a1
View in 3D
