Lineage for d4kqvb_ (4kqv B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667910Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1667911Protein automated matches [226867] (11 species)
    not a true protein
  7. 1667937Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries)
  8. 1667945Domain d4kqvb_: 4kqv B: [236038]
    Other proteins in same PDB: d4kqva2
    automated match to d4hxza1
    protein/DNA complex; complexed with doo, iod

Details for d4kqvb_

PDB Entry: 4kqv (more details), 2.38 Å

PDB Description: topoisomerase iv atp binding domain of francisella tularensis in complex with a small molecule inhibitor
PDB Compounds: (B:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4kqvb_:

Sequence, based on SEQRES records: (download)

>d4kqvb_ d.122.1.0 (B:) automated matches {Francisella tularensis [TaxId: 376619]}
sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva
ddgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrlea
eikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknll
eakailckaltikysneikkekltwhfetg

Sequence, based on observed residues (ATOM records): (download)

>d4kqvb_ d.122.1.0 (B:) automated matches {Francisella tularensis [TaxId: 376619]}
sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva
ddgrgmpvdihpehkmsgielimtklhsggkvgvsvvnalstrleaeikrdgnvyhivfe
dgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailckaltiky
sneikkekltwhfetg

SCOPe Domain Coordinates for d4kqvb_:

Click to download the PDB-style file with coordinates for d4kqvb_.
(The format of our PDB-style files is described here.)

Timeline for d4kqvb_: