Lineage for d4kqva1 (4kqv A:7-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974068Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries)
  8. 2974073Domain d4kqva1: 4kqv A:7-215 [236036]
    Other proteins in same PDB: d4kqva2
    automated match to d4hxza1
    protein/DNA complex; complexed with doo, iod

Details for d4kqva1

PDB Entry: 4kqv (more details), 2.38 Å

PDB Description: topoisomerase iv atp binding domain of francisella tularensis in complex with a small molecule inhibitor
PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4kqva1:

Sequence, based on SEQRES records: (download)

>d4kqva1 d.122.1.0 (A:7-215) automated matches {Francisella tularensis [TaxId: 376619]}
ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
addgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrle
aeikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknl
leakailckaltikysneikkekltwhfe

Sequence, based on observed residues (ATOM records): (download)

>d4kqva1 d.122.1.0 (A:7-215) automated matches {Francisella tularensis [TaxId: 376619]}
ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
addgrgmpvdihpehkmsgielimtklhsggkfsngvgvsvvnalstrleaeikrdgnvy
hivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailcka
ltikysneikkekltwhfe

SCOPe Domain Coordinates for d4kqva1:

Click to download the PDB-style file with coordinates for d4kqva1.
(The format of our PDB-style files is described here.)

Timeline for d4kqva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kqva2
View in 3D
Domains from other chains:
(mouse over for more information)
d4kqvb_