Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (18 species) not a true protein |
Species Acidaminococcus fermentans [TaxId:591001] [236033] (2 PDB entries) |
Domain d4kpub_: 4kpu B: [236034] automated match to d1o97c_ complexed with cl, fad |
PDB Entry: 4kpu (more details), 1.6 Å
SCOPe Domain Sequences for d4kpub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kpub_ c.26.2.0 (B:) automated matches {Acidaminococcus fermentans [TaxId: 591001]} mnivvcvkqvpdtaemkidpvtnnlvrdgvtnimnpydqyaletalqlkdelgahvtvit mgpphaesvlrdclavgadeaklvsdrafggadtlatsaamantikhfgvpdlilcgrqa idgdtaqvgpeiaehlglpqvtaalkvqvkddtvvvdrdneqmsmtftmkmpcvvtvmrs kdlrfasirgkmkarkaeipvytaaaleipldiigkagsptqvmksftpkvtqvhgeifd dedpavavdklvnkliedkiitk
Timeline for d4kpub_: