SCOPe 2.05: Domain d4kpub_: 4kpu B:

Lineage for d4kpub_ (4kpu B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (18 species)
   not a true protein

7. Species Acidaminococcus fermentans [TaxId:591001] [236033] (2 PDB entries)

8. Domain d4kpub_: 4kpu B: [236034]
   automated match to d1o97c_
   complexed with cl, fad

Details for d4kpub_

PDB Entry: 4kpu, 1.6 Å

PDB Description: Electron transferring flavoprotein of Acidaminococcus fermentans: Towards a mechanism of flavin-based electron bifurcation

PDB Compounds: (B:) Electron transfer flavoprotein alpha/beta-subunit

SCOPe Domain Sequences for d4kpub_:

Sequence; same for both SEQRES and ATOM records:

>d4kpub_ c.26.2.0 (B:) automated matches {Acidaminococcus fermentans [TaxId: 591001]}
mnivvcvkqvpdtaemkidpvtnnlvrdgvtnimnpydqyaletalqlkdelgahvtvit
mgpphaesvlrdclavgadeaklvsdrafggadtlatsaamantikhfgvpdlilcgrqa
idgdtaqvgpeiaehlglpqvtaalkvqvkddtvvvdrdneqmsmtftmkmpcvvtvmrs
kdlrfasirgkmkarkaeipvytaaaleipldiigkagsptqvmksftpkvtqvhgeifd
dedpavavdklvnkliedkiitk

Timeline for d4kpub_:

• d4kpub_ first appeared in SCOPe 2.03
  
• d4kpub_ appears in SCOPe 2.04
  
• d4kpub_ appears in SCOPe 2.06
  
• d4kpub_ appears in the current release, SCOPe 2.08