Lineage for d4kfga_ (4kfg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973765Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2973823Protein automated matches [191126] (3 species)
    not a true protein
  7. 2973824Species Escherichia coli K-12 [TaxId:83333] [226425] (3 PDB entries)
  8. 2973827Domain d4kfga_: 4kfg A: [236030]
    automated match to d4hypd_
    protein/DNA complex; complexed with doo, so4

Details for d4kfga_

PDB Entry: 4kfg (more details), 1.6 Å

PDB Description: The DNA Gyrase B ATP binding domain of Escherichia coli in complex with a small molecule inhibitor.
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4kfga_:

Sequence, based on SEQRES records: (download)

>d4kfga_ d.122.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelvi
qregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrel
sflnsgvsirlrdkrdgkedhfhye

Sequence, based on observed residues (ATOM records): (download)

>d4kfga_ d.122.1.2 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgivsaaevimtvlkvsgglhgvgvsvvnalsqklelviqregkihrqiyehgvp
qaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsirlrdkrd
gkedhfhye

SCOPe Domain Coordinates for d4kfga_:

Click to download the PDB-style file with coordinates for d4kfga_.
(The format of our PDB-style files is described here.)

Timeline for d4kfga_: