Lineage for d4k4oa1 (4k4o A:18-224)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974002Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries)
  8. 2974003Domain d4k4oa1: 4k4o A:18-224 [236029]
    Other proteins in same PDB: d4k4oa2
    automated match to d4geea_
    protein/DNA complex; complexed with doo, tbu

Details for d4k4oa1

PDB Entry: 4k4o (more details), 1.3 Å

PDB Description: The DNA Gyrase B ATP binding domain of Enterococcus faecalis in complex with a small molecule inhibitor
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4k4oa1:

Sequence, based on SEQRES records: (download)

>d4k4oa1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy
kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela
flnrglhisiedrregqedkkeyhyeg

Sequence, based on observed residues (ATOM records): (download)

>d4k4oa1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlgssvvnalstsldvrvykdgkvyyqeyrrgavvddlk
vieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregqedk
keyhyeg

SCOPe Domain Coordinates for d4k4oa1:

Click to download the PDB-style file with coordinates for d4k4oa1.
(The format of our PDB-style files is described here.)

Timeline for d4k4oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k4oa2