Lineage for d4j1pa_ (4j1p A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731541Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)
  8. 1731543Domain d4j1pa_: 4j1p A: [236025]
    automated match to d3onia_
    complexed with 1k0, edo

Details for d4j1pa_

PDB Entry: 4j1p (more details), 1.08 Å

PDB Description: X-ray crystal structure of bromodomain 2 of human brd2 in complex with rvx208 to 1.08 A resolution
PDB Compounds: (A:) Bromodomain containing 2, isoform CRA_a

SCOPe Domain Sequences for d4j1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j1pa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkr
kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

SCOPe Domain Coordinates for d4j1pa_:

Click to download the PDB-style file with coordinates for d4j1pa_.
(The format of our PDB-style files is described here.)

Timeline for d4j1pa_: