SCOPe 2.08: Domain d4j1pa1: 4j1p A:344-455

Lineage for d4j1pa1 (4j1p A:344-455)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d4j1pa1: 4j1p A:344-455 [236025]
   Other proteins in same PDB: d4j1pa2
   automated match to d3onia_
   complexed with 1k0, edo

Details for d4j1pa1

PDB Entry: 4j1p, 1.08 Å

PDB Description: X-ray crystal structure of bromodomain 2 of human brd2 in complex with rvx208 to 1.08 A resolution

PDB Compounds: (A:) Bromodomain containing 2, isoform CRA_a

SCOPe Domain Sequences for d4j1pa1:

Sequence; same for both SEQRES and ATOM records:

>d4j1pa1 a.29.2.0 (A:344-455) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

Timeline for d4j1pa1:

• d4j1pa1 first appeared in SCOPe 2.03, called d4j1pa_
  
• d4j1pa1 appears in SCOPe 2.07