Lineage for d4iq2a_ (4iq2 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408349Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1408560Protein automated matches [191209] (3 species)
    not a true protein
  7. 1408561Species Human (Homo sapiens) [TaxId:9606] [189839] (33 PDB entries)
  8. 1408593Domain d4iq2a_: 4iq2 A: [236024]
    automated match to d1c9ha_
    complexed with mla

Details for d4iq2a_

PDB Entry: 4iq2 (more details), 1.7 Å

PDB Description: p21 crystal form of fkbp12.6
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase fkbp1b

SCOPe Domain Sequences for d4iq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iq2a_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gveietispgdgrtfpkkgqtvvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
egaaqmslgqrakltitpdvaygatghpgvippnatlifdvellnle

SCOPe Domain Coordinates for d4iq2a_:

Click to download the PDB-style file with coordinates for d4iq2a_.
(The format of our PDB-style files is described here.)

Timeline for d4iq2a_: