Lineage for d3hj3d2 (3hj3 D:193-521)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428979Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1428980Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1428981Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1429236Protein automated matches [190469] (12 species)
    not a true protein
  7. 1429244Species Cryptosporidium hominis [TaxId:237895] [232024] (2 PDB entries)
  8. 1429251Domain d3hj3d2: 3hj3 D:193-521 [236023]
    Other proteins in same PDB: d3hj3b1, d3hj3d1
    automated match to d3hj3a2
    complexed with cb3, mtx, ndp, ump; mutant

Details for d3hj3d2

PDB Entry: 3hj3 (more details), 2.7 Å

PDB Description: crystal structure of the chts-dhfr f207a non-active site mutant
PDB Compounds: (D:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d3hj3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hj3d2 d.117.1.1 (D:193-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
lksiddtvdllgeiagirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlenga
yrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgdtngnhliekk
vyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakli
etlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgsp
fniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkrk
veniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d3hj3d2:

Click to download the PDB-style file with coordinates for d3hj3d2.
(The format of our PDB-style files is described here.)

Timeline for d3hj3d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hj3d1