SCOPe 2.03: Domain d3hj3d1: 3hj3 D:3-178

Lineage for d3hj3d1 (3hj3 D:3-178)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (16 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [231999] (2 PDB entries)

8. Domain d3hj3d1: 3hj3 D:3-178 [236022]
   Other proteins in same PDB: d3hj3b2, d3hj3d2
   automated match to d3hj3a1
   complexed with cb3, mtx, ndp, ump; mutant

Details for d3hj3d1

PDB Entry: 3hj3, 2.7 Å

PDB Description: crystal structure of the chts-dhfr f207a non-active site mutant

PDB Compounds: (D:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d3hj3d1:

Sequence; same for both SEQRES and ATOM records:

>d3hj3d1 c.71.1.0 (D:3-178) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekq

Timeline for d3hj3d1:

• d3hj3d1 is new in SCOPe 2.03-stable
  
• d3hj3d1 appears in SCOPe 2.04
  
• d3hj3d1 appears in the current release, SCOPe 2.08