Lineage for d4ippa_ (4ipp A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1345791Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 1345792Family c.1.20.1: tRNA-guanine transglycosylase [51714] (3 proteins)
  6. 1345803Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 1345821Species Zymomonas mobilis [TaxId:542] [51716] (57 PDB entries)
    Uniprot P28720
  8. 1345827Domain d4ippa_: 4ipp A: [236021]
    automated match to d1q2ra_
    complexed with gol, zn; mutant

Details for d4ippa_

PDB Entry: 4ipp (more details), 1.33 Å

PDB Description: tRNA-guanine-transglycosylase (TGT) mutant V262D APO-Structure
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d4ippa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ippa_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
mlpddkphylmgdgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
fsqfaqdfraryfa

SCOPe Domain Coordinates for d4ippa_:

Click to download the PDB-style file with coordinates for d4ippa_.
(The format of our PDB-style files is described here.)

Timeline for d4ippa_: