SCOPe 2.08: Domain d3hj3b2: 3hj3 B:192-521

Lineage for d3hj3b2 (3hj3 B:192-521)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries)

8. Domain d3hj3b2: 3hj3 B:192-521 [236020]
   Other proteins in same PDB: d3hj3a1, d3hj3b1, d3hj3c1, d3hj3d1
   automated match to d3hj3a2
   complexed with cb3, mtx, ndp, ump; mutant

Details for d3hj3b2

PDB Entry: 3hj3, 2.7 Å

PDB Description: crystal structure of the chts-dhfr f207a non-active site mutant

PDB Compounds: (B:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d3hj3b2:

Sequence; same for both SEQRES and ATOM records:

>d3hj3b2 d.117.1.1 (B:192-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
qlksiddtvdllgeiagirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvleng
ayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgdtngnhliek
kvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakl
ietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgs
pfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkr
kveniedfkwedieligyypyptikmdmav

Timeline for d3hj3b2:

• d3hj3b2 first appeared in SCOPe 2.03
  
• d3hj3b2 appears in SCOPe 2.07