Lineage for d1a45_1 (1a45 1-84)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) Protein gamma-Crystallin [49697] (4 species) 
Species Cow (Bos taurus), isoform F [TaxId:9913] [49701] (1 PDB entry) 
Domain d1a45_1: 1a45 1-84 [23602]
Details for d1a45_1
PDB Entry: 1a45 (more details), 2.3 Å
PDB Description: gammaf crystallin from bovine lens
SCOP Domain Sequences for d1a45_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a45_1 b.11.1.1 (1-84) gamma-Crystallin {Cow (Bos taurus), isoform F}
gkitfyedrgfqgrhyecssdhsnlqpyfsrcnsirvdsgcwmlyeqpnfqgpqyflrrg
dypdyqqwmglndsirscrlipht
SCOP Domain Coordinates for d1a45_1:
Click to download the PDB-style file with coordinates for d1a45_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a45_1:
- d1a45_1 first appeared (with stable ids) in SCOP 1.55
- d1a45_1 appears in SCOP 1.59
- d1a45_1 appears in the current release, SCOPe 2.08, called d1a45a1
View in 3D
