![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.1: Sialidases [50939] (3 families) ![]() |
![]() | Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
![]() | Protein automated matches [190692] (7 species) not a true protein |
![]() | Species Enterobacteria phage [TaxId:948870] [236008] (1 PDB entry) |
![]() | Domain d4hizb1: 4hiz B:105-603 [236012] Other proteins in same PDB: d4hiza2, d4hizb2 automated match to d1v0ea1 complexed with ca, cl, edo, mg, na, suc |
PDB Entry: 4hiz (more details), 1.6 Å
SCOPe Domain Sequences for d4hizb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hizb1 b.68.1.0 (B:105-603) automated matches {Enterobacteria phage [TaxId: 948870]} nltfkvttlpdiskfknaafvyerivgqpltyvsegffdgnltkitdtpfynawtqdktf vydnviyapfmagerhgvqnlhvawvksgddgqtwsmpewltpihpdytadkvnyhcmsm gvcgnrlyavietrylsnmrlkkaelwsrpmpyyrrptggitissgsttativlkkhglk vgdavnfsnsgatgvsgnmtvasvinkdtftvtlaraatsnidntgttwhfgtrfwdspw eitelpdvaystnadlcvtethsftvidddnytfavgyhngdisprrlgilyfnnaysdp ssftrrtisqeyadnaaepcikyydgilylttrgtstsaagstlamsadlgenwnylrfp nnvhhtnlpfakvgdylyifgtersfgewegqeldnrykgtyprtfmckinvsswpvsls nvqwfnitdqiyqghivnsacgvgsvcvkdgwlyyifggedflspwsigdnskklwykhd ghpadlysyrlkitehdfv
Timeline for d4hizb1: