Lineage for d4hiza1 (4hiz A:99-603)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (15 species)
    not a true protein
  7. 2065393Species Enterobacteria phage [TaxId:948870] [236008] (1 PDB entry)
  8. 2065394Domain d4hiza1: 4hiz A:99-603 [236011]
    Other proteins in same PDB: d4hiza2, d4hizb2, d4hizc2
    automated match to d1v0ea1
    complexed with ca, cl, edo, mg, na, suc

Details for d4hiza1

PDB Entry: 4hiz (more details), 1.6 Å

PDB Description: phage phi92 endosialidase
PDB Compounds: (A:) Endosialidase

SCOPe Domain Sequences for d4hiza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hiza1 b.68.1.0 (A:99-603) automated matches {Enterobacteria phage [TaxId: 948870]}
wiidgrnltfkvttlpdiskfknaafvyerivgqpltyvsegffdgnltkitdtpfynaw
tqdktfvydnviyapfmagerhgvqnlhvawvksgddgqtwsmpewltpihpdytadkvn
yhcmsmgvcgnrlyavietrylsnmrlkkaelwsrpmpyyrrptggitissgsttativl
kkhglkvgdavnfsnsgatgvsgnmtvasvinkdtftvtlaraatsnidntgttwhfgtr
fwdspweitelpdvaystnadlcvtethsftvidddnytfavgyhngdisprrlgilyfn
naysdpssftrrtisqeyadnaaepcikyydgilylttrgtstsaagstlamsadlgenw
nylrfpnnvhhtnlpfakvgdylyifgtersfgewegqeldnrykgtyprtfmckinvss
wpvslsnvqwfnitdqiyqghivnsacgvgsvcvkdgwlyyifggedflspwsigdnskk
lwykhdghpadlysyrlkitehdfv

SCOPe Domain Coordinates for d4hiza1:

Click to download the PDB-style file with coordinates for d4hiza1.
(The format of our PDB-style files is described here.)

Timeline for d4hiza1: