Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (18 species) not a true protein |
Species Candida parapsilosis [TaxId:5480] [224874] (3 PDB entries) |
Domain d4h8nb_: 4h8n B: [236010] automated match to d4h8na_ complexed with ndp |
PDB Entry: 4h8n (more details), 1.8 Å
SCOPe Domain Sequences for d4h8nb_:
Sequence, based on SEQRES records: (download)
>d4h8nb_ c.1.7.0 (B:) automated matches {Candida parapsilosis [TaxId: 5480]} llpktfrtksgkeisialgtgtkwkqaqtindvstelvdnillglklgfrhidtaeaynt qkevgealkrtdvprediwvttkyspgwgsikayskspsdsidkalaqlgvdyvdlflih spfftteqthgytleqawealveakkagkvreigisnaaiphleklfaaspspeyypvvn qiefhpflqnqsknivrfcqehgilveafsplaplarvetnalaetlkrlaekykkteaq vllrytlqrgilpvttsskesrlkeslnlfdfeltdeevneinkigdanpyraffheqfk dl
>d4h8nb_ c.1.7.0 (B:) automated matches {Candida parapsilosis [TaxId: 5480]} llpktfrtksgkeisialgtgtkwkqaqvstelvdnillglklgfrhidtaeayntqkev gealkrtdvprediwvttkyspgwgsikayskspsdsidkalaqlgvdyvdlflihspff tteqthgytleqawealveakkagkvreigisnaaiphleklfaaspspeyypvvnqief hpflqnqsknivrfcqehgilveafsplaplarvetnalaetlkrlaekykkteaqvllr ytlqrgilpvttsskesrlkeslnlfdfeltdeevneinkigdanpyraffheqfkdl
Timeline for d4h8nb_: