![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) ![]() |
![]() | Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) |
![]() | Protein gamma-Crystallin [49697] (7 species) duplication consists of two domains of this fold |
![]() | Species Cow (Bos taurus), isoform S [TaxId:9913] [49700] (1 PDB entry) |
![]() | Domain d1a7hb_: 1a7h B: [23601] C-terminal domain only mutant |
PDB Entry: 1a7h (more details), 2.56 Å
SCOP Domain Sequences for d1a7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7hb_ b.11.1.1 (B:) gamma-Crystallin {Cow (Bos taurus), isoform S} mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll dkkeyrkpvdwgaaspavqsfrrive
Timeline for d1a7hb_: