SCOP 1.65: Domain d1a7hb_: 1a7h B:

Lineage for d1a7hb_ (1a7h B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein gamma-Crystallin [49697] (6 species)
   duplication consists of two domains of this fold

7. Species Cow (Bos taurus), isoform S [TaxId:9913] [49700] (1 PDB entry)

8. Domain d1a7hb_: 1a7h B: [23601]
   C-terminal domain only
   mutant

Details for d1a7hb_

PDB Entry: 1a7h, 2.56 Å

PDB Description: gamma s crystallin c-terminal domain

SCOP Domain Sequences for d1a7hb_:

Sequence; same for both SEQRES and ATOM records:

>d1a7hb_ b.11.1.1 (B:) gamma-Crystallin {Cow (Bos taurus), isoform S}
mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll
dkkeyrkpvdwgaaspavqsfrrive

Timeline for d1a7hb_:

• d1a7hb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7hb_ appears in SCOP 1.63
  
• d1a7hb_ appears in SCOP 1.67
  
• d1a7hb_ appears in the current release, SCOPe 2.08