| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
| Protein gamma-Crystallin [49697] (9 species) duplication consists of two domains of this fold |
| Species Cow (Bos taurus), isoform S [TaxId:9913] [49700] (1 PDB entry) |
| Domain d1a7hb_: 1a7h B: [23601] C-terminal domain only |
PDB Entry: 1a7h (more details), 2.56 Å
SCOPe Domain Sequences for d1a7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7hb_ b.11.1.1 (B:) gamma-Crystallin {Cow (Bos taurus), isoform S [TaxId: 9913]}
mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll
dkkeyrkpvdwgaaspavqsfrrive
Timeline for d1a7hb_: