Lineage for d4c80a2 (4c80 A:81-193)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715259Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 2715262Species Desulfovibrio gigas [TaxId:879] [47744] (12 PDB entries)
    Uniprot Q46509
  8. 2715271Domain d4c80a2: 4c80 A:81-193 [236002]
    Other proteins in same PDB: d4c80a1, d4c80a3, d4c80a4
    automated match to d1vlba1
    complexed with bct, cl, fes, ipa, mg, na, pcd, peo

Details for d4c80a2

PDB Entry: 4c80 (more details), 1.5 Å

PDB Description: aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with hydrogen peroxide
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d4c80a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c80a2 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOPe Domain Coordinates for d4c80a2:

Click to download the PDB-style file with coordinates for d4c80a2.
(The format of our PDB-style files is described here.)

Timeline for d4c80a2: