Lineage for d4c7ya4 (4c7y A:311-907)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670288Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 1670289Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 1670290Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 1670297Protein Aldehyde oxidoreductase [56005] (2 species)
  7. 1670300Species Desulfovibrio gigas [TaxId:879] [56006] (11 PDB entries)
    Uniprot Q46509
  8. 1670309Domain d4c7ya4: 4c7y A:311-907 [236000]
    Other proteins in same PDB: d4c7ya1, d4c7ya2, d4c7ya3
    automated match to d1vlba4
    complexed with bct, cl, fes, ipa, mg, pcd, peo

Details for d4c7ya4

PDB Entry: 4c7y (more details), 1.57 Å

PDB Description: aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d4c7ya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7ya4 d.133.1.1 (A:311-907) Aldehyde oxidoreductase {Desulfovibrio gigas [TaxId: 879]}
msgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyvgrqphmpiep
dvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggtfgykfsptse
alvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllamesdwlvdhgp
ysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqsmfaseclmdm
laeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaalekaqkestat
hkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadigcvgtahealr
pmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkacekpgggyytyd
elkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdvatgqttvdgmt
lmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpfikqipdkldi
vyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypekvlealka

SCOPe Domain Coordinates for d4c7ya4:

Click to download the PDB-style file with coordinates for d4c7ya4.
(The format of our PDB-style files is described here.)

Timeline for d4c7ya4: