SCOPe 2.07: Domain d1a7ha_: 1a7h A:

Lineage for d1a7ha_ (1a7h A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein gamma-Crystallin [49697] (9 species)
   duplication consists of two domains of this fold

7. Species Cow (Bos taurus), isoform S [TaxId:9913] [49700] (1 PDB entry)

8. Domain d1a7ha_: 1a7h A: [23600]
   C-terminal domain only

Details for d1a7ha_

PDB Entry: 1a7h, 2.56 Å

PDB Description: gamma s crystallin c-terminal domain

PDB Compounds: (A:) gammas crystallin

SCOPe Domain Sequences for d1a7ha_:

Sequence; same for both SEQRES and ATOM records:

>d1a7ha_ b.11.1.1 (A:) gamma-Crystallin {Cow (Bos taurus), isoform S [TaxId: 9913]}
mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll
dkkeyrkpvdwgaaspavqsfrrive

Timeline for d1a7ha_:

• d1a7ha_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7ha_ appears in SCOPe 2.06
  
• d1a7ha_ appears in the current release, SCOPe 2.08