Lineage for d1a7ha_ (1a7h A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11845Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
  4. 11846Superfamily b.11.1: gamma-Crystallin-like [49695] (5 families) (S)
  5. 11847Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 11870Protein gamma-Crystallin [49697] (4 species)
  7. 11889Species Cow (Bos taurus), isoform S [TaxId:9913] [49700] (1 PDB entry)
  8. 11890Domain d1a7ha_: 1a7h A: [23600]

Details for d1a7ha_

PDB Entry: 1a7h (more details), 2.56 Å

PDB Description: gamma s crystallin c-terminal domain

SCOP Domain Sequences for d1a7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7ha_ b.11.1.1 (A:) gamma-Crystallin {Cow (Bos taurus), isoform S}
mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqyll
dkkeyrkpvdwgaaspavqsfrrive

SCOP Domain Coordinates for d1a7ha_:

Click to download the PDB-style file with coordinates for d1a7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1a7ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a7hb_