Lineage for d4c7ya3 (4c7y A:194-310)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2551903Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2551904Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2551911Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species)
  7. 2551914Species Desulfovibrio gigas [TaxId:879] [54668] (12 PDB entries)
    Uniprot Q46509
  8. 2551922Domain d4c7ya3: 4c7y A:194-310 [235998]
    Other proteins in same PDB: d4c7ya1, d4c7ya2, d4c7ya4
    automated match to d1vlba3
    complexed with bct, cl, fes, ipa, mg, pcd, peo

Details for d4c7ya3

PDB Entry: 4c7y (more details), 1.57 Å

PDB Description: aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d4c7ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7ya3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio gigas [TaxId: 879]}
dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg
litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay

SCOPe Domain Coordinates for d4c7ya3:

Click to download the PDB-style file with coordinates for d4c7ya3.
(The format of our PDB-style files is described here.)

Timeline for d4c7ya3: