Lineage for d4c7za2 (4c7z A:81-193)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737421Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1737422Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1737423Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 1737430Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 1737433Species Desulfovibrio gigas [TaxId:879] [47744] (11 PDB entries)
    Uniprot Q46509
  8. 1737440Domain d4c7za2: 4c7z A:81-193 [235996]
    Other proteins in same PDB: d4c7za1, d4c7za3, d4c7za4
    automated match to d1vlba1
    complexed with bct, cl, fes, ipa, mg, pcd, peo

Details for d4c7za2

PDB Entry: 4c7z (more details), 1.55 Å

PDB Description: aldehyde oxidoreductase from desulfovibrio gigas (mop), activated with sodium dithionite and sodium sulfide
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d4c7za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7za2 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOPe Domain Coordinates for d4c7za2:

Click to download the PDB-style file with coordinates for d4c7za2.
(The format of our PDB-style files is described here.)

Timeline for d4c7za2: