Lineage for d4c2bd_ (4c2b D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111565Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2111716Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 2111753Protein automated matches [235852] (2 species)
    not a true protein
  7. 2111754Species Human (Homo sapiens) [TaxId:9606] [235853] (2 PDB entries)
  8. 2111757Domain d4c2bd_: 4c2b D: [235991]
    Other proteins in same PDB: d4c2ba_, d4c2bc_, d4c2be_, d4c2bg_
    automated match to d4c2ab_
    complexed with mes, peg, so4; mutant

Details for d4c2bd_

PDB Entry: 4c2b (more details), 2.8 Å

PDB Description: Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha
PDB Compounds: (D:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d4c2bd_:

Sequence, based on SEQRES records: (download)

>d4c2bd_ c.10.2.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
picevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltqln
ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
glgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllqe
nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavts
nvasvqcdnsdkfpvykypgkgcp

Sequence, based on observed residues (ATOM records): (download)

>d4c2bd_ c.10.2.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
picevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltqln
ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
glgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllqe
nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavts
nvasvqcdnkfpvykypgkgcp

SCOPe Domain Coordinates for d4c2bd_:

Click to download the PDB-style file with coordinates for d4c2bd_.
(The format of our PDB-style files is described here.)

Timeline for d4c2bd_: