![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) |
![]() | Protein automated matches [235852] (1 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [235853] (2 PDB entries) |
![]() | Domain d4c2bd_: 4c2b D: [235991] Other proteins in same PDB: d4c2ba_, d4c2bc_, d4c2be_, d4c2bg_ automated match to d4c2ab_ complexed with mes, peg, so4; mutant |
PDB Entry: 4c2b (more details), 2.8 Å
SCOPe Domain Sequences for d4c2bd_:
Sequence, based on SEQRES records: (download)
>d4c2bd_ c.10.2.7 (D:) automated matches {Homo sapiens [TaxId: 9606]} picevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltqln ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr glgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllqe nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavts nvasvqcdnsdkfpvykypgkgcp
>d4c2bd_ c.10.2.7 (D:) automated matches {Homo sapiens [TaxId: 9606]} picevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltqln ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr glgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllqe nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavts nvasvqcdnkfpvykypgkgcp
Timeline for d4c2bd_: