Lineage for d4c2bc_ (4c2b C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892349Protein automated matches [190060] (2 species)
    not a true protein
  7. 2892352Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)
  8. 2892378Domain d4c2bc_: 4c2b C: [235990]
    Other proteins in same PDB: d4c2bb_, d4c2bd_, d4c2bf_, d4c2bh_
    automated match to d4c29a_
    complexed with mes, peg, so4; mutant

Details for d4c2bc_

PDB Entry: 4c2b (more details), 2.8 Å

PDB Description: Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha
PDB Compounds: (C:) von willebrand factor

SCOPe Domain Sequences for d4c2bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2bc_ c.62.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgsha
yiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmas
qepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdele
qqrdeivsylcdlapeapp

SCOPe Domain Coordinates for d4c2bc_:

Click to download the PDB-style file with coordinates for d4c2bc_.
(The format of our PDB-style files is described here.)

Timeline for d4c2bc_: