Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
Protein automated matches [190060] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186779] (11 PDB entries) |
Domain d4c2bg_: 4c2b G: [235988] Other proteins in same PDB: d4c2bb_, d4c2bd_, d4c2bf_, d4c2bh_ automated match to d4c29a_ complexed with mes, peg, so4; mutant |
PDB Entry: 4c2b (more details), 2.8 Å
SCOPe Domain Sequences for d4c2bg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2bg_ c.62.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshay iglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasq epqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleq qrdeivsylcdlapeap
Timeline for d4c2bg_: