Lineage for d1elpb1 (1elp B:1-85)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369998Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 369999Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) (S)
  5. 370000Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 370028Protein gamma-Crystallin [49697] (7 species)
    duplication consists of two domains of this fold
  7. 370047Species Cow (Bos taurus), isoform IIIb (D) [TaxId:9913] [49699] (1 PDB entry)
  8. 370050Domain d1elpb1: 1elp B:1-85 [23598]

Details for d1elpb1

PDB Entry: 1elp (more details), 1.95 Å

PDB Description: gamma-d crystallin structure at 1.95 a resolution

SCOP Domain Sequences for d1elpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elpb1 b.11.1.1 (B:1-85) gamma-Crystallin {Cow (Bos taurus), isoform IIIb (D)}
gkitfyedrgfqgrhyecssdhsnlqpylgrcnsvrvdsgcwmiyeqpnylgpqyflrrg
dypdyqqwmglndsirscrliphag

SCOP Domain Coordinates for d1elpb1:

Click to download the PDB-style file with coordinates for d1elpb1.
(The format of our PDB-style files is described here.)

Timeline for d1elpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1elpb2